PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4507s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 319aa    MW: 36389.2 Da    PI: 8.5007
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4507s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31160213255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+v++Ltl+hvkSHLQ+YR+
  Araha.4507s0021.1.p 160 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQMYRT 213
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.84E-15157214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27158214IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-23160214IPR006447Myb domain, plants
PfamPF002499.6E-7161212IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MELFPSQPDL YLKISQRREE NQELQEQEVE RRLGFQSKAS DSDRKSSDNL IHTHQFTSNN  60
EATKINNNQE HKESLDQDLR SMLMMRPIRG IPLYQNQVLD HYYYSSSSPT PFFFSEVNGQ  120
HASSRLITNP NCSFNIHHRH RRQAQPQPPR FTAKRGVRAP RMRWTTTLHA HFVHAVQLLG  180
GHERATPKSV LELMDVQDLT LAHVKSHLQM YRTIKSTEKP TTSSGHSDTC ENGSQVNSER  240
EARNLQGLWN NSSSEARFHL KAKASSAVDI SSNENEWKNQ RCPSNERLSS DSSSLTGTRP  300
ETETPNLDFT LATPNLSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0486900.0AY048690.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI3 (KAN3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002868045.10.0hypothetical protein ARALYDRAFT_493108
SwissprotQ941I20.0KAN3_ARATH; Probable transcription factor KAN3
TrEMBLD7M9G70.0D7M9G7_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.7__2541__AT4G17695.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139841825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.11e-171G2-like family protein